PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID CCG033677.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family NF-YA
Protein Properties Length: 269aa    MW: 30102 Da    PI: 8.6796
Description NF-YA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
CCG033677.1genomeLZUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1CBFB_NFYA103.22.4e-32173229158
    CBFB_NFYA   1 deplYVNaKQyqrIlkRRqkRakleeekkldeksrkpylheSRhkhAlrRpRgsgGrF 58 
                  +ep++VNaKQy++Il+RRq+Rak+e e+k  +ksrkpylheSRh+hAl+R+Rg+gGrF
  CCG033677.1 173 EEPVFVNAKQYHGILRRRQSRAKAELENKA-IKSRKPYLHESRHQHALKRARGCGGRF 229
                  69****************************.**************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005213.2E-36171232IPR001289Nuclear transcription factor Y subunit A
PROSITE profilePS5115237.666172232IPR001289Nuclear transcription factor Y subunit A
PfamPF020454.5E-27174229IPR001289Nuclear transcription factor Y subunit A
PRINTSPR006161.9E-23175197IPR001289Nuclear transcription factor Y subunit A
PROSITE patternPS006860177197IPR018362CCAAT-binding factor, conserved site
PRINTSPR006161.9E-23206229IPR001289Nuclear transcription factor Y subunit A
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0016602Cellular ComponentCCAAT-binding factor complex
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 269 aa     Download sequence    Send to blast
MLLMINYDNN IIFKSCFPDN SEAGEQKHSE PQVQTSSPAN ALAHPGISPP NFQCATPQLG  60
AGHAMAPAAY PYPDPYYRSI FAPYDAQPYA PQPYGAQPMP FSAAAKGFEK NLKWRNEIEE  120
MNLEPKKCRQ THHVLWAIMV VGVGECNDGE FWVHLQLMGI QQAGVPLPSD AVEEPVFVNA  180
KQYHGILRRR QSRAKAELEN KAIKSRKPYL HESRHQHALK RARGCGGRFL NSKKKENQQQ  240
NDMAPGDKPQ SNINLNANKN DIASLDDKS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4awl_A3e-21172242171NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT ALPHA
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1826932e-87AC182693.2 Populus trichocarpa clone Pop1-44N6, complete sequence.
GenBankAC1878642e-87AC187864.2 Populus trichocarpa clone Pop1-32E3, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011012079.11e-135PREDICTED: nuclear transcription factor Y subunit A-7-like isoform X1
RefseqXP_011012080.11e-135PREDICTED: nuclear transcription factor Y subunit A-7-like isoform X1
RefseqXP_011012081.11e-135PREDICTED: nuclear transcription factor Y subunit A-7-like isoform X1
TrEMBLB9NB871e-126B9NB87_POPTR; CCAAT-binding transcription factor family protein
STRINGPOPTR_0011s10080.11e-126(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF53793355
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G30500.26e-49nuclear factor Y, subunit A7